SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 338966.Ppro_1842 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338966.Ppro_1842
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000575
Family SPO1678-like 0.019
Further Details:      
 
Weak hits

Sequence:  338966.Ppro_1842
Domain Number - Region: 50-97
Classification Level Classification E-value
Superfamily Prefoldin 0.0392
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338966.Ppro_1842
Sequence length 102
Comment (Pelobacter propionicus DSM 2379)
Sequence
MRKKRHNYTPEEKVAILKRHLVDHVAISDLCDEYQLQPTIFYGWLKQFFENGASAFVRDT
GRQKRIEEQRIQQLEDKLRRKHEVLSELMEEHIKLKKGLGEL
Download sequence
Identical sequences A1AQ34
WP_011735730.1.31684 338966.Ppro_1842 2005158335 2005486422 gi|118580262|ref|YP_901512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]