SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 338966.Ppro_3312 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338966.Ppro_3312
Domain Number 1 Region: 314-471
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-31
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 209-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.35e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Weak hits

Sequence:  338966.Ppro_3312
Domain Number - Region: 34-84
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0523
Family F1F0 ATP synthase subunit B, membrane domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338966.Ppro_3312
Sequence length 521
Comment (Pelobacter propionicus DSM 2379)
Sequence
MQVSIWMLVITVLAAVAAYFAGSRVNKKDSGLIVKQSEELAAKMIDDARREAETITKEAD
LKARAEIIEAKAGHDREITEKKKDLQILEKRLQQKEENLDKKFGLIEQKELDMLKKEQSF
VAREQNLAAKSEELSRASDVQQAKLEEISGMSASEAKKELMTSMEDEAKHDAAKRIKAIE
EEARETADKKAKEIISLAVQRYAGEYVAEKTVSVVPLPSDEMKGRIIGREGRNIRALEAA
TGIDLIIDDTPEAVILSGFNPVRREVARMSLEKLIGDGRIHPGRIEEVVAKATEEVDLGI
KEAGERAAFDLGVHGIHPEIIKLIGRLKYRTSYTQNIYQHSLEVAFICGIMAAELGINVK
QAKRAGLLHDLGKAVDHEVEGSHAVIGADLARKYGESAKIVHAIMAHHEDEKPNSVLAVL
VQAADALSGARPGARREMMETYVKRLDDLERIATSFGGVTNSFAIQAGREIRVMVSSDHV
TDEQSLIMARDIAKKIEAEMTYPGQIKVNVIRETRAVEYAR
Download sequence
Identical sequences A1AU84
338966.Ppro_3312 WP_011737122.1.31684 gi|118581712|ref|YP_902962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]