SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 338969.Rfer_0490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338969.Rfer_0490
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.22e-31
Family Chaperone J-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 134-225
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000103
Family HSP40/DnaJ peptide-binding domain 0.0042
Further Details:      
 
Domain Number 3 Region: 224-300
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000131
Family HSP40/DnaJ peptide-binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 338969.Rfer_0490
Sequence length 326
Comment (Rhodoferax ferrireducens T118)
Sequence
MAGRMQVEFKDYYQIMGLQRSATQDEIKRAHRTLARKYHPDVSKEPNAEARFKEIGEAYE
VLKDPEKRAAYDQLGANWKGGQEFRPPPDWNAGFETGGAGFGAGEAGDYSDFFESLFSRG
FGAQRGGRRGGAAFHAPGQDRHAKIQIDLEDAYQGAKRRVTLQVPTLDAQGHVATREHTI
EFSIPKGVRAGQQIRLAGQGDPGMGQGAPGDLYLEIEFRAHAHYRIDKHDVYLDLPVAPW
EAALGAQIEVPTPSGFVELKIPAGSVEGRKLRLKGRGIPARTPGDFYFVLKIALPPADSE
AAQAFYRSMATQFKSFKPRARLGAAA
Download sequence
Identical sequences Q221R1
gi|89899302|ref|YP_521773.1| 338969.Rfer_0490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]