SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 338969.Rfer_1849 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338969.Rfer_1849
Domain Number 1 Region: 3-124,189-289
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.8e-45
Family FabD-like 0.00043
Further Details:      
 
Domain Number 2 Region: 127-187
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000183
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338969.Rfer_1849
Sequence length 307
Comment (Rhodoferax ferrireducens T118)
Sequence
MTYALVFSGQASQHPTMLPWLDTDPMAADALHAMGLCLGANWRTAIQDEGCRSNNAFAQV
LITGTSLAAWAAVKDKLPQAPAVVAGYSVGELSAFACAGVFSTDQAIALAAQRAALMDQA
VSGLHTGLLAVSGISEGRVLAVSAGLGLECAIRVNPSQAVFAGTDDALSQAALALGAAGA
VCKRLDVRVASHSSWMAQAAHAFSDVLSALPFAAPFCPIATNAYGVLSRQPAELRQALGQ
QLACTVRWSSCMEALAERQVSCVLEIGAGSALARMWNERYPDIPARSLDEFQGPKGAAQW
VGMHFSS
Download sequence
Identical sequences Q21XC8
gi|89900635|ref|YP_523106.1| 338969.Rfer_1849 WP_011464143.1.86502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]