SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 339670.Bamb_1678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339670.Bamb_1678
Domain Number 1 Region: 26-144
Classification Level Classification E-value
Superfamily PapD-like 1.91e-24
Family Pilus chaperone 0.0037
Further Details:      
 
Weak hits

Sequence:  339670.Bamb_1678
Domain Number - Region: 148-230
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.000124
Family Periplasmic chaperone C-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 339670.Bamb_1678
Sequence length 245
Comment (Burkholderia cepacia AMMD)
Sequence
MKFPARHTLRASLLAPLLGCLIGSSVVHAMGVVPETSVVIVDEADGEGTISVRNTDTHPT
LLHTTVEPIPEDKAELLIVTPPIARVEGGAVQLVRFVLAGNEPLVTQRLARVSFSGIPPK
RQNKNEIQTIIRQNLPVLIQPQDLARNDRPWELLKWSIEDGKLIVRNDSRYVVRLEQKVQ
LLPSGQIVSLPAPYVLAGQTRRIALAREAATPERVRLFPATVYGYSVDHYDAALAPAAAA
AATQR
Download sequence
Identical sequences Q0BF38
WP_011656959.1.34573 WP_011656959.1.59090 gi|115351730|ref|YP_773569.1| 339670.Bamb_1678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]