SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 339860.Msp_1363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339860.Msp_1363
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 7.98e-49
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0000781
Further Details:      
 
Domain Number 2 Region: 140-270
Classification Level Classification E-value
Superfamily Translational machinery components 3.75e-42
Family ERF1/Dom34 middle domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 273-410
Classification Level Classification E-value
Superfamily L30e-like 8.24e-37
Family ERF1/Dom34 C-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 339860.Msp_1363
Sequence length 411
Comment (Methanosphaera stadtmanae)
Sequence
MSDVSSKEIYEVKKTLKELEDKKGRGTELVSVYIPPEKQISDVAKQMRDELGQSANIKSK
QTRKNVQSAIEVIIQRLKLFPKPPEKGLVMFVGMIPKGGPGTEKMETYVFQPPEAVQTYT
YHCDSQFFVEPLKQIIEYKEVYGVVVLDRKESTIATLRGKRIDIIKHLTSGVPGKHKAGG
QSQRRFDRVIELAAHEFLKRIGRHVDEAFLPLKDELKGVLIGGPGHTKNDFVDGEYIHYE
IHDKIINIVDTSYTGDFGIREVIDESADTLDEMDIMQEKKFMRKFLTGLISESGLSTYGE
KEVRQNLQMGAVETLLISENLKSKRQTYTCPACNTVDVITTRQHQEPPEKRCPKCNEVMK
ITKTQETAEELIELAEEVKTHVEVISIETEEGTQLDKAFGGIAGILRYKVK
Download sequence
Identical sequences A0A1D2WHQ5 Q2NEL3
339860.Msp_1363 gi|84490151|ref|YP_448383.1| WP_011406939.1.14142 WP_011406939.1.32456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]