SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 340099.Teth39_2148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340099.Teth39_2148
Domain Number 1 Region: 28-145
Classification Level Classification E-value
Superfamily TM1646-like 3.14e-29
Family TM1646-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340099.Teth39_2148
Sequence length 146
Comment (Thermoanaerobacter pseudethanolicus ATCC 33223)
Sequence
MRIEEVKSPKISSDIKSEYNRSYRVTKNFIDTFDEELEQFHRDKLNGILSEIDSAAQKLK
ESLTLQDLINYKKLVKKFLQEATSGMLKYTKKEYVDARGRKKIYSLVEKANDKLEKLTEE
FLKDSKHLELLKMIDDIRGLLIDIYS
Download sequence
Identical sequences A0A124F7F1 B0K121 B0K7K5 C7IRA5 E8URS9
WP_003867354.1.26562 WP_003867354.1.2934 WP_003867354.1.47445 WP_003867354.1.56562 WP_003867354.1.81593 WP_003867354.1.95568 gi|167038529|ref|YP_001666107.1| gi|307723299|ref|YP_003903050.1| 340099.Teth39_2148 399726.Teth514_0055 gi|320116925|ref|YP_004187084.1| gi|167038729|ref|YP_001661714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]