SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 340100.Bpet4131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340100.Bpet4131
Domain Number 1 Region: 22-141
Classification Level Classification E-value
Superfamily PapD-like 1.07e-36
Family Pilus chaperone 0.0003
Further Details:      
 
Domain Number 2 Region: 135-228
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.00000000406
Family Periplasmic chaperone C-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 340100.Bpet4131
Sequence length 241
Comment (Bordetella petrii)
Sequence
MKTLIQRLFLAATVVGMLAGGVAQAAVQLSSTRVIMNAEQQHVSVFAKNLSSEPYVVQTW
IDGSAEEMDTPFFVTPPLSRFDGDVERRLTITRVGEGLPEDRESYYWINVLEIPQKKDRE
ENVLSLAMHTRIKLFYRPAGIQKLPRDRELLKWSVAREGTTCQLVAENSSAFLVNFARIE
FPGEANEFGRGVVAAPLAPTRIPLSKCPAAAGAQVIPHVVNDYGVIEPWPAAVASPEATG
R
Download sequence
Identical sequences A9I9L5
WP_012251020.1.34756 gi|163858449|ref|YP_001632747.1| 340100.Bpet4131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]