SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_2348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_2348
Domain Number 1 Region: 3-239
Classification Level Classification E-value
Superfamily PIN domain-like 5.89e-65
Family 5' to 3' exonuclease catalytic domain 0.000000377
Further Details:      
 
Domain Number 2 Region: 225-346
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.64e-31
Family 5' to 3' exonuclease, C-terminal subdomain 0.0000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_2348
Sequence length 346
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MGVTELGKLIGKEARREVKLEALAGRCVALDAYNALYQFLASIRQPDGTPLMDRAGRITS
HISGLFYRTINLMEAGIKPVYVFDGKPPEFKLAEIEERRKAKEKATEELVRAIKEGRRDE
VAKYAKRAIFLTNEMVEDAKKLLTYMGVPWVQAPSEGEAQAAYMARRGHCWAVGSQDYDS
LLFGSPRLVRNLATSPKRKVGDEVVELSPEIIELDAVLKSLRLRSREQLIDLAILLGTDY
NPDGVPGIGPQRALKLIWEFGSLEKLLDTVLRGVTFPIDPVEIKRFFLNPPVTDTYTTDV
TKPDDAKLRDFLVHEHDFGEERVERALERLKKAMGKLRTSALDSFF
Download sequence
Identical sequences A4WNC4
340102.Pars_2348 gi|145592541|ref|YP_001154543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]