SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 340177.Cag_0818 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340177.Cag_0818
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000729
Family PIN domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 340177.Cag_0818
Sequence length 130
Comment (Chlorobium chlorochromatii CaD3)
Sequence
MSKRVVTDTMAIVLRLEQRKLPQQVRNIFLKAEQEECTIIIPTMVFAEIGYLSERGRIDV
TLDDVRTYCTQHPNIVESALTQAIVAHSFTINDIPELHDRLIAGTASYQQLPLLTNDPII
TQSQHLTVIW
Download sequence
Identical sequences Q3ASE1
WP_011361853.1.38767 gi|78188789|ref|YP_379127.1| 340177.Cag_0818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]