SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 340177.Cag_1541 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340177.Cag_1541
Domain Number 1 Region: 322-471
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.2e-21
Family HD domain 0.02
Further Details:      
 
Domain Number 2 Region: 213-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000128
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 340177.Cag_1541
Sequence length 524
Comment (Chlorobium chlorochromatii CaD3)
Sequence
MGIVINLLLLVLAALVAFVAGFFIGRYFLERIGTTKVLEAEERAVQIVQEAQKEANEYKE
LKVSEVNQEWKKKRREFEQDVLIKNNKFAQLQKQLQQREAQLKKQSQDVRDAERKLQDQR
KEVEQLSDSVKLRATELERVIVEQNQRLESISNLQADEARQMLIDNMVTQAREEASNTIH
RIHEEAEQQATRMAEKTLITAIQRISFEQTTENALSVVHIQSDELKGRIIGREGRNIKAF
ENATGVDIIVDDTPEVVILSCFDPLRRELAKLTLKKLLADGIIHPVAIEKAYADATKEID
DVVYSAGEEVAASLQLNDIPTEVIALLGKMKFHTVYGQNLLQHSREVAMLAGVMAAELKL
DARMAKRAGLLHDIGLVLPESDEPHAITGMNFMKKFNESDQLLNAIGAHHGDMEKESPLA
DLVDAANTISLSRPGARGAVTADGNVKRLESLEEIAKGFPGVLKTYALQAGREIRVIVEG
DNVSDSQADMLAHDIARKIESEAQYPGQIKVSIIREKRSVAYAK
Download sequence
Identical sequences Q3AQC9
WP_011362559.1.38767 340177.Cag_1541 gi|78189501|ref|YP_379839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]