SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 340322.cgR_1151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340322.cgR_1151
Domain Number 1 Region: 108-278
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.61e-52
Family NadC C-terminal domain-like 0.00000818
Further Details:      
 
Domain Number 2 Region: 4-107
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.06e-28
Family NadC N-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 340322.cgR_1151
Sequence length 279
Comment (Corynebacterium glutamicum R)
Sequence
MTNHTDRIVGAALSEDAPWGDITSDTFIPGSAQLSAKVVAREPGVFSGQALFDASFRLVD
PRINASLKVADGDSFETGDILGTITGSARSILRSERIALNFIQRTSGIATLTSCYVAEVK
GTKARIVDTRKTTPGLRIIERQAVRDGGGFNHRATLSDAVMVKDNHLAAIASQGLSITEA
LLNMKAKLPHTTHVEVEVDHIEQIEPVLAAGVDTIMLDNFTIDQLIEGVDLIGGRALVEA
SGGVNLNTVGKIASTGVDVISVGALTHSVHALDLGLDIF
Download sequence
Identical sequences A4QD32
gi|145295210|ref|YP_001138031.1| WP_011897035.1.2455 340322.cgR_1151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]