SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 342108.amb4032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342108.amb4032
Domain Number 1 Region: 14-70
Classification Level Classification E-value
Superfamily PGBD-like 0.00000314
Family MMP N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 342108.amb4032
Sequence length 185
Comment (Magnetospirillum magneticum AMB-1)
Sequence
MSIDLNDTIGSSYPADPGDVLNVKTSMNNLGYYDPPAAYGLTPWPDTPMFDGIKNFQKDH
DLEVDGIMHPDGPTVTTMNKGLAQGEDSPSDGNEQLAYNPAAANLLDMMLQRGTKGGGGG
NSCPGDRAPRSGDECDELYNADSSICRSLPPVPRIRRNCWSSASERNAACRSGRPLPPLD
SSDRP
Download sequence
Identical sequences Q2VZY9
gi|83313131|ref|YP_423395.1| 342108.amb4032 WP_011386385.1.61852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]