SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 342108.amb4329 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342108.amb4329
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily LigT-like 1.74e-46
Family 2'-5' RNA ligase LigT 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 342108.amb4329
Sequence length 178
Comment (Magnetospirillum magneticum AMB-1)
Sequence
MIRLFVGIGFDEELTARIATLQRGLPGARWIEPANLHLTLRFIGEVDEDLAEEIHRGLDA
LVEPPFALTLAGLGLFGDRHQAHTLWLGVERSDALSRLAARIESAAVQAGAEPETRRFNP
HVTLARLKHTPPGRIQDFIDATGPFREEHVAVERFTLFRSTLGRQGAQYDALEHYPLG
Download sequence
Identical sequences Q2VZ42
gi|83313428|ref|YP_423692.1| 342108.amb4329 WP_011386677.1.61852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]