SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 342451.SSP1185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342451.SSP1185
Domain Number 1 Region: 90-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.29e-38
Family Tandem AAA-ATPase domain 0.063
Further Details:      
 
Domain Number 2 Region: 9-65
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000691
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 342451.SSP1185
Sequence length 315
Comment (Staphylococcus saprophyticus)
Sequence
MPGIIQINDINEAQALIGNNDEHLKSIEEGFDVIIHARGQEIAVKGEQVEHVEKAESVLI
NLLKVIQQGVTISIKDVEAAVKMAQNGTIQYLLDLYEDEITKDAFGKTIRAKTMGQRLYV
NAMHHNDLVFGVGPAGTGKTFLAVVYAAKQLRKGSVKRIVLTRPAVEAGESLGFLPGDLK
EKVDPYLRPLYDGLNTVLGREQTARFIERGIIEVAPLAYMRGRTLDDAFVILDEAQNTTH
AQMKMFLTRLGFGSKMVVTGDKTQVDLPKGVKSGLKEAIKKLENVKGLSIHHLDQTDVVR
HPLVSKIIDRYEGDE
Download sequence
Identical sequences A0A0E3CSR6 A0A0G7GQJ3 A0A2K3Y3V8 Q49Y14
WP_002483161.1.15358 WP_002483161.1.15726 WP_002483161.1.18345 WP_002483161.1.18592 WP_002483161.1.25302 WP_002483161.1.26712 WP_002483161.1.27163 WP_002483161.1.28029 WP_002483161.1.28454 WP_002483161.1.31168 WP_002483161.1.37492 WP_002483161.1.37647 WP_002483161.1.38289 WP_002483161.1.43091 WP_002483161.1.43215 WP_002483161.1.45004 WP_002483161.1.53552 WP_002483161.1.54785 WP_002483161.1.59350 WP_002483161.1.63267 WP_002483161.1.66168 WP_002483161.1.68345 WP_002483161.1.68604 WP_002483161.1.74667 WP_002483161.1.76174 WP_002483161.1.77974 WP_002483161.1.8052 WP_002483161.1.81985 WP_002483161.1.82244 WP_002483161.1.84863 WP_002483161.1.9070 WP_002483161.1.91454 WP_002483161.1.94572 gi|73662494|ref|YP_301275.1| 342451.SSP1185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]