SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 342451.SSP1511 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342451.SSP1511
Domain Number 1 Region: 152-292
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 7.85e-51
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000373
Further Details:      
 
Domain Number 2 Region: 55-143
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.7e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0015
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily UBA-like 8.93e-21
Family TS-N domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 342451.SSP1511
Sequence length 292
Comment (Staphylococcus saprophyticus)
Sequence
MAISAKLVKELREKTGAGMMDCKKALTETDGDIDKAVDFLREKGIAKAAKKSDRIAAEGL
VHVEERGNEAAIVEINSETDFVARNEGFQQLVKEIAIQVLDTKAETVEALLETNLPDGKS
VDQRVKEAISTIGEKLSIRRFAVRTKTDNDSFGAYLHMGGRIGVLTVVEGSTDAEAAKDV
AMHIAAINPKYVSSEQVSEDEIAHERDVLKQQALNEGKPENIVEKMVEGRLRKYLQEICA
VDQNFVKNPDQTVEAFLKSKGGKLVDFVRYEVGEGMEKREENFADEVKGQMK
Download sequence
Identical sequences A0A0G7H0X7 A0A2K3YC01 Q49X42
gi|73662820|ref|YP_301601.1| WP_011303262.1.25302 WP_011303262.1.74667 WP_011303262.1.8052 342451.SSP1511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]