SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 342610.Patl_1632 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342610.Patl_1632
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-48
Family Ribonuclease PH domain 1-like 0.0000158
Further Details:      
 
Domain Number 2 Region: 291-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-46
Family Ribonuclease PH domain 1-like 0.000021
Further Details:      
 
Domain Number 3 Region: 144-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.37e-29
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.4e-28
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 5 Region: 608-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.86e-21
Family Cold shock DNA-binding domain-like 0.00015
Further Details:      
 
Domain Number 6 Region: 553-620
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000675
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 342610.Patl_1632
Sequence length 703
Comment (Pseudoalteromonas atlantica T6c)
Sequence
MTPITKSFQYGQHTVTLETGVIARQATAAVMASMDDTSVLVSVVGKKDTKPGQDFFPLTV
NYQERTYAAGKIPGGFFKREGRPSEYETLTSRLIDRPIRPLFPDGFMNEVQIIVTVVSAN
PEIPTDIISLIGTSAALAISGMPFNGPVGAARVGYTDGQYVLNTRTSELEISQLDLVVAG
TKGAVLMVESEAEVLSEDVMLGAVMFGHEQMQTVVNAVTEFAAEVNTPKWDWVAEPANVT
LKDKIKALAEAEMTEAYQISDKMARKDAIVALTDKTVAAIVEADAEQDAKEVSELLHELE
SDVVRSRILAGQPRIDGRDPAMIRALDVATGILPRTHGSALFTRGETQAIVAATLGTERD
AQMIDGLNGKVDSRFMLHYNFPPYCVGETGFVGSPKRREIGHGRLAKRGIQAVMPSEKEF
PYVVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKASVAGIAMGLVKNDENFVVLSDI
LGDEDHLGDMDFKVAGTTEGITALQMDIKIEGITQEIMQVALKQAKEARLHILGVMDQAI
SGHRDEMSEFAPRIYTLKIDQDKIRDVIGKGGAMIRSITEASDTNIEIEDDGTIKIFATE
RAKADIAISKIEQVTADVEAGKTYEGKVTRIVDFGAFVEILPGKEGLVHISQIAHERVNK
VADHLSEGQIINVKVMEIDRQNRVRLSIKELLEKPAAPAEGNE
Download sequence
Identical sequences Q15VD4
WP_011574461.1.28837 gi|109897953|ref|YP_661208.1| 342610.Patl_1632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]