SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 344609.SbBS512_E3607 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  344609.SbBS512_E3607
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 301-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.68e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-31
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.95e-27
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 5 Region: 226-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.15e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 608-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-23
Family Cold shock DNA-binding domain-like 0.0000219
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 344609.SbBS512_E3607
Sequence length 711
Comment (Shigella boydii CDC 3083 94)
Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLT
VNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIATVVSV
NPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVA
GTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNE
ALNARVAALAEARLSDAYRITDKQERYAQVDVIKSETIATLLAEDETLDENELGEILHAI
EKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTAR
DAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDK
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSD
ILGDEDHLGDMDFKVAGSREGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQA
INAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIRALTDETGTTIEIEDDGTVKIAAT
DGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQPAAAPEAPAAEQGE
Download sequence
Identical sequences B2U211
344609.SbBS512_E3607 gi|187732493|ref|YP_001881919.1| WP_012421483.1.14129 WP_012421483.1.19129 WP_012421483.1.28536 WP_012421483.1.3598 WP_012421483.1.41271 WP_012421483.1.49104 WP_012421483.1.51307 WP_012421483.1.54585 WP_012421483.1.57851 WP_012421483.1.60453 WP_012421483.1.62266 WP_012421483.1.68731 WP_012421483.1.71149 WP_012421483.1.79464 WP_012421483.1.79922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]