SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 345073.VC0395_0562 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  345073.VC0395_0562
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.54e-36
Family Multidomain sulfurtransferase (rhodanese) 0.00033
Further Details:      
 
Domain Number 2 Region: 157-276
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.06e-30
Family Multidomain sulfurtransferase (rhodanese) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 345073.VC0395_0562
Sequence length 276
Comment (Vibrio cholerae O395)
Sequence
MTSPLVTAQWLQQHLHDPNLVILDSSIEFQIPTESEKDWINKIPNAQRFDYDKEFCDPDS
PLPHMMPSEQRFNTLARELGINQDSIIVVYDNSGTFASPRAWWMFKAMGHHKVYILNGGL
TEWKAQGYNVTQNYREPTTKGNFDGKLNPQAFVDASYVLKQIDNPHSQTIDARGLARFFG
EVPEPRPGVRSGHIPGSSCLPFAELITGHKLKEQAELRPLLTHMLPETAQEYLFSCGSGV
TACIVLLAAYVCGYQNLSVYDGSWTEWGQRQDLPIE
Download sequence
Identical sequences A0A0H3AF03 A0A2K0RV28
gi|147672034|ref|YP_001215401.1| gi|147672034|ref|YP_001215401.1| WP_000203689.1.14179 WP_000203689.1.15134 WP_000203689.1.17738 WP_000203689.1.19428 WP_000203689.1.2316 WP_000203689.1.25649 WP_000203689.1.26223 WP_000203689.1.28508 WP_000203689.1.34261 WP_000203689.1.34643 WP_000203689.1.36322 WP_000203689.1.40782 WP_000203689.1.46540 WP_000203689.1.47794 WP_000203689.1.52676 WP_000203689.1.53085 WP_000203689.1.56807 WP_000203689.1.65528 WP_000203689.1.70775 WP_000203689.1.78428 WP_000203689.1.89719 WP_000203689.1.96693 345073.VC0395_0562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]