SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 347255.RAF_ORF0108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347255.RAF_ORF0108
Domain Number 1 Region: 150-307
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.22e-43
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000692
Further Details:      
 
Domain Number 2 Region: 58-146
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 4.71e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00059
Further Details:      
 
Domain Number 3 Region: 5-58
Classification Level Classification E-value
Superfamily UBA-like 1.73e-18
Family TS-N domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 347255.RAF_ORF0108
Sequence length 309
Comment (Rickettsia africae ESF 5)
Sequence
MSEINISAVAVKELREKTGAGMMDCKKALIETSGNFEEAIDFLRKKGLAAAAKKAGRIAS
EGLTAAKVDGLTGVVIEVNSETDFVARNEQFQDLVKDIANLAVIAKTIDTLKTFKMQSGK
SVEEEIIENIATIGENLTLRRMDILEISEGAIGSYVHNEVVPNLGKISVLVGLASNAKDK
AKLEALAKQIAVHVAGNNPQSIDDSSLDQALVERERKVFFEKSKEEGKPDNIIAKMVEGR
IRKFFSEVVLLQQNFLFEPKLTVAEVIKNAEKELGAEIKIAKFIRYELGEGIEHEEKNFA
DEVAAITQG
Download sequence
Identical sequences C3PMC3
347255.RAF_ORF0108 WP_012719375.1.29537 gi|229586325|ref|YP_002844826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]