SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 347255.RAF_ORF0608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347255.RAF_ORF0608
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-44
Family Ribonuclease PH domain 1-like 0.0000805
Further Details:      
 
Domain Number 2 Region: 295-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-43
Family Ribonuclease PH domain 1-like 0.0000247
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.45e-28
Family Ribonuclease PH domain 2-like 0.0000908
Further Details:      
 
Domain Number 4 Region: 149-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.23e-24
Family Ribonuclease PH domain 2-like 0.0027
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 621-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.69e-18
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000243
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 347255.RAF_ORF0608
Sequence length 748
Comment (Rickettsia africae ESF 5)
Sequence
MFNEITKSVTWNGQVLELSTGKIARQADGAVTVKMGNSVLLCTAVVANKAKEGIGFLPLT
INYREMAYAAGKIPGGFFKHEGKASDREVLVSRLIDRPIRPLFHPAFVNETHVTCSVLSY
DPETPVDILAIIGASAALSLSPAPYLEIVAASKVGLINGEFVLNPTLALLKTSQLDLVVA
GTSDSVMMVESEAHLLSEEQMLEAVKFGFESFQPVIKIIKELAEEAKKPKLEMQALYPAS
LKKEIEKLFVKEIEQAFAIKSKQERSTNLDLIPEKVLTHFVSDIENKKYSNYQIESALKA
IESDILRNEILEKNRRIDGRSTTDIRQIACEIGLLPSAHGSALFTRGETQSLVSTTFGTS
LDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKAPSRREVGHGKLAWRAINPILPNKV
QFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPIKAPVAGIAMGLVKEGKNFAVLS
DILGDEDYFGDMDFKVAGTSEGITALQMDIKISGVDFKIMKVALEQARLGRLHILEQMNK
VISKPNNELSKNAPSTTTIKIDKDKIRDIIGPGGKVIKEICETSGAKIDISDDGTVSVYA
SDRDKLKVALDKIKAIVVEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERI
ETVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNADKDKSSNNTKPKTNVNNTKDNSEPEQR
RDSSKKRAWNEDNNAETAEVITERKYFN
Download sequence
Identical sequences C3PNK2
347255.RAF_ORF0608 WP_012719724.1.29537 gi|229586754|ref|YP_002845255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]