SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 347257.MAG_0490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347257.MAG_0490
Domain Number 1 Region: 114-168
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000615
Family ComEA-like 0.047
Further Details:      
 
Weak hits

Sequence:  347257.MAG_0490
Domain Number - Region: 59-101
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0556
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 347257.MAG_0490
Sequence length 170
Comment (Mycoplasma agalactiae PG2)
Sequence
MRIKRFVIGSLVLIAVATSTIAITFESNRTSFSKISPSDSDVVAIDVTGAVLFKGRHYFK
KGVKLREILNVVKENNADLSNIDMNKEYKNNVKIFIPFLKNNFDNDVNKQIHWLELNDEQ
QLRKLGISVNVSKQLVQLRRKKSKVKWDDIQSLRGIGEKTFSKLKRVLVL
Download sequence
Identical sequences A5IXI7
gi|148377317|ref|YP_001256193.1| WP_011949231.1.3023 347257.MAG_0490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]