SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 347834.RHE_CH00111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  347834.RHE_CH00111
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-52
Family Ribonuclease PH domain 1-like 0.0000212
Further Details:      
 
Domain Number 2 Region: 295-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-49
Family Ribonuclease PH domain 1-like 0.0000111
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.75e-30
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 451-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.05e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.16e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.2e-20
Family Cold shock DNA-binding domain-like 0.00051
Further Details:      
 
Domain Number 7 Region: 240-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.38e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 347834.RHE_CH00111
Sequence length 712
Comment (Rhizobium etli CFN 42)
Sequence
MFDTHTVEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATVVSAKAPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFPEGYKNDTQVVVTVVQH
DLENNPDILSMIASSAALTLSGVPFMGPVGGARVGYINGEYVLNPHLDEMDESSLDLVVA
GTYDAVLMVESEAKELPEDVMLGAVMFGHKGFQPVLDAIIKLAEVAAKEPRDFQPEDYSE
LEGEMLKHFEAELREAYKITQKADRYAAVDAVKAKVKAHFLPEEGEAKYTAEEVGAIFKH
LQAKIVRWNILDTKSRIDGRDLETVRPIVSEVGLLPRTHGSALFTRGETQAIVVATLGTG
EDEQYVDSLTGMYKERFLLHYNFPPFSVGETGRMGSPGRREIGHGKLAWRAIRPMLPSAE
QFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPLAKPVAGIAMGLILEGDRFAVLS
DILGDEDHLGDMDFKVAGTADGITSLQMDIKIAGITEEIMKVALGQAKGGRAHILGEMAK
AITESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKVIREIVEKTGAKINIEDDGTVKIAS
SSGKEIEAARKWIHSIVAEPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERV
AKTTDVVKEGDKVWVKLLGFDERGKVRLSMKVVDQATGQEIPNEKKKEEAAE
Download sequence
Identical sequences A0A192LQD1 Q2KE00 S5SCN1
WP_011423507.1.27780 WP_011423507.1.2956 WP_011423507.1.36336 WP_011423507.1.37232 WP_011423507.1.47285 WP_011423507.1.49343 WP_011423507.1.61485 WP_011423507.1.62937 WP_011423507.1.76939 WP_011423507.1.93170 WP_011423507.1.964 WP_011423507.1.98140 gi|528826965|ref|YP_008362921.1| ReR142 gi|86355771|ref|YP_467663.1| 347834.RHE_CH00111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]