SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP1144A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP1144A
Domain Number 1 Region: 23-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000304
Family Hypothetical protein PH1932 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 348780.NP1144A
Sequence length 114
Comment (Natronomonas pharaonis)
Sequence
MCVNELVPTELDADSDRDLETVTIDDGDVLEALSSETARRVLQALDSGPAPASAVAETAG
VSIQVAAYHLDRLETAGLVRTVATSYSEKGQPMDIYGLTTDSFVVELSGGDSPR
Download sequence
Identical sequences A0A1U7EUK9
348780.NP1144A gi|76801224|ref|YP_326232.1| WP_011322299.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]