SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349101.Rsph17029_2774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349101.Rsph17029_2774
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-50
Family Ribonuclease PH domain 1-like 0.0000238
Further Details:      
 
Domain Number 2 Region: 298-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.71e-47
Family Ribonuclease PH domain 1-like 0.0000144
Further Details:      
 
Domain Number 3 Region: 453-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.43e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 145-242
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.73e-25
Family Ribonuclease PH domain 2-like 0.0027
Further Details:      
 
Domain Number 5 Region: 558-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.68e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 623-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.36e-21
Family Cold shock DNA-binding domain-like 0.00041
Further Details:      
 
Domain Number 7 Region: 246-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000243
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349101.Rsph17029_2774
Sequence length 716
Comment (Rhodobacter sphaeroides ATCC 17029)
Sequence
MFNVTKKSIEWGGETLTLETGKVARQADGSVIATLGETSVMANVTFAKAAKPGQDFFPLT
VHYQERYYAAGKVPGGFFKREARPSEKETLTSRLIDRPIRPLFVDGFKNEVLLIVTVLSH
DLVNEPDIVAMIAASAALTISGVPFMGPIGAARVGFAGGEYVLNPDVDDMQKLRENPEQR
LDLVIAGTKDAVMMVESEAYELSEAEMLGAVKFGHEAMQPVIDMIIDFAEEAAHEPFDFS
PPDYAALYAKVKSLGETQMRAAFAIREKQDRVNAIDAARAAIKAQLSEAELADENLGTAF
KKLESSILRGDIINGGARIDGRDTKTVRPIISETSVLPRTHGSALFTRGETQALVVTTLG
TGEDEQIIDALHGNSRSNFLLHYNFPPYSVGEVGRFGPPGRREIGHGKLAWRALQAVLPA
ATDFPYTIRVVSEITESNGSSSMASVCGGSLSMMDAGVPLKAPVAGVAMGLILEDDGKWA
VLTDILGDEDHLGDMDFKVAGTENGITSLQMDIKVAGITPEIMEQALAQAKDGRMHILGE
MSKALSSANSFSAYAPKIETLTIPTDKIREVIGSGGKVIREIVETSGAKVDINDDGVIKI
ASNDQAAIKKAYDMIWSIVAEPEEGQIYTGKVVKLVDFGAFVNFFGKRDGLVHVSQIANK
RLTHPNEVLKEGQEVKVKLLGFDERGKVRLGMKMVDQETGQEIQPEKKEKEEAGEA
Download sequence
Identical sequences A3PNG0 Q3IYT7
RhR106 272943.RSP_1112 349101.Rsph17029_2774 gi|77464694|ref|YP_354198.1| WP_002721512.1.22285 WP_002721512.1.29994 WP_002721512.1.46944 WP_002721512.1.62547 WP_002721512.1.80699 WP_002721512.1.8565 YP_354198.1.90827 gi|126463534|ref|YP_001044648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]