SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349102.Rsph17025_2536 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349102.Rsph17025_2536
Domain Number 1 Region: 9-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.85e-59
Family G proteins 0.000000185
Further Details:      
 
Domain Number 2 Region: 295-390
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.39e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000554
Further Details:      
 
Domain Number 3 Region: 202-298
Classification Level Classification E-value
Superfamily Translation proteins 5.2e-30
Family Elongation factors 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349102.Rsph17025_2536
Sequence length 391
Comment (Rhodobacter sphaeroides ATCC 17025)
Sequence
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFRAYDQIDGAPEERARGITIST
AHVEYESESRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHILLGRQ
VGIPYMVVYMNKVDQVDDPELLELVEMEIRELLSSYDYPGDDIPIIKGSALAAMNGTDKE
IGEDSIRALIAAVDEYIPTPARAVDQPFLMPVEDVFSISGRGTVATGRIERGVVKVGEEL
EIVGIRPSKKTVCTGVEMFRKLLDQGEAGDNVGLLLRGVDRDGIERGQVLCKPGSVKPHT
KFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVELPEGTEMVMPGDNLKFNVEL
IAPIAMEEKLRFAIREGGRTVGAGVVSKIIA
Download sequence
Identical sequences A4WVL0
349102.Rsph17025_2536 349102.Rsph17025_2549 WP_011909488.1.61369 gi|146278570|ref|YP_001168729.1| gi|146278583|ref|YP_001168742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]