SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349102.Rsph17025_4374 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  349102.Rsph17025_4374
Domain Number - Region: 24-48
Classification Level Classification E-value
Superfamily PRP4-like 0.0102
Family PRP4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349102.Rsph17025_4374
Sequence length 85
Comment (Rhodobacter sphaeroides ATCC 17025)
Sequence
MQKIFIAIAGAAIFLGLAGCKEEEKHPVAFFVENPAARVQRLADCEFQDRSADDANCVNA
REAERQTASERDAKGFQSTFGKPAF
Download sequence
Identical sequences A4X0Q5
349102.Rsph17025_4374 WP_011911230.1.61369 gi|146280369|ref|YP_001170524.1| gi|146280369|ref|YP_001170524.1|NC_009432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]