SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349106.PsycPRwf_0589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349106.PsycPRwf_0589
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 1.84e-32
Family Ribosomal protein L28 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349106.PsycPRwf_0589
Sequence length 78
Comment (Psychrobacter PRwf-1)
Sequence
MSRVCQVTGKRPQVGNNVSHAHNKTRRRFLPNLHNHRFWVESENRFVRLRVSTKGMRIID
KHGIDKVLADLRAKGEKV
Download sequence
Identical sequences A5WD03
WP_011959870.1.63326 gi|148652401|ref|YP_001279494.1| 349106.PsycPRwf_0589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]