SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349161.Dred_1711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349161.Dred_1711
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily PP2C-like 6.15e-65
Family PP2C-like 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349161.Dred_1711
Sequence length 238
Comment (Desulfotomaculum reducens MI-1)
Sequence
MKWSQISDVGRVRPGNEDSMCACPDIGLFAVADGMGGHKAGEIASRTVIEYLVENLRNSN
VEKEDIATNLLRILDEANLRIHRLSNEIEEYRGMGTTVTAGIFVDNKLIIAHVGDSRAYL
IRHDDIIQITNDHSLVGEMLRCGGITEEQAINHPQKNVLTRAMGTAPMVRLDLHTVDLKV
GDKILFCTDGLINHLRPEEIKHVIKGQPDLDKCLEELMDLTLERGGTDNSTIVLVEVE
Download sequence
Identical sequences A4J585
349161.Dred_1711 WP_011878052.1.64742 gi|134299567|ref|YP_001113063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]