SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349161.Dred_1919 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349161.Dred_1919
Domain Number 1 Region: 308-459
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.84e-31
Family HD domain 0.016
Further Details:      
 
Domain Number 2 Region: 203-296
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.59e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349161.Dred_1919
Sequence length 512
Comment (Desulfotomaculum reducens MI-1)
Sequence
MEFQIILVVIISALVGLVIGFFIRKNIAEGKITSAEAQAKRILEEAEKNAEGKKREAIVM
AKEEVLKLRNEMEREIRDRRNELQRLERRLLQKEETLDRKMDSMEKKEESLSRKEADIEN
TKAELTNVLNRQLAELERVSGLSSEEARQILLNDVEKELQHDMAVMIKDFENRAKEEADK
KARDIISSAIQRCAADHVAEATVAVIPLPNDEMKGRIIGREGRNIRAFETLTGIDLIIDD
TPEAVILSGFDPIRREVARLALERLISDGRIHPARIEEMVEKAQKDVEVQIREAGEQATF
ETGVHGLHPELVKLLGRLKFRTSYGQNVLKHSIEVCHLAGLMAAELGIDVKLAKRAGLLH
DIGKAVDHEVEGPHVAIGVNLCQKYKESPEVIHAIAAHHGDEEPRTIEAVLVQAADAISA
ARPGARRETLESYIKRLQKLEEIAGTFEGVEKSFAIQAGREIRIMVKPDKIDDLAAIRLV
RDIAKKIENELDYPGQIKVIIIRETRYVEYAK
Download sequence
Identical sequences A4J5T7
WP_011878251.1.64742 349161.Dred_1919 gi|134299769|ref|YP_001113265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]