SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349163.Acry_2252 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  349163.Acry_2252
Domain Number - Region: 170-190
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0902
Family Mitotic arrest deficient-like 1, Mad1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349163.Acry_2252
Sequence length 197
Comment (Acidiphilium cryptum JF-5)
Sequence
MPQTPDGTKPIVIKKYANRRLYNTESSTYITLETLSEMVREGRDFEVFDAKTGEDITRAV
LTQIIVEEESKVGQAMLPTNFLRQLIGLYGNNMQGVVPRFLEQAMSQFSRQQSQMRAAMQ
QTMGNFIPPGMEEIGRQNMAMMERAMSLFSPFGAQGEASAAGADDHGAAEEIETLRAEVE
RLQAELAALRARAPKRA
Download sequence
Identical sequences A0A066PQT7 A5G0R5 F0J2B0
349163.Acry_2252 WP_012039911.1.19560 WP_012039911.1.41512 WP_012039911.1.67004 WP_012039911.1.88836 WP_012039911.1.96862 gi|148261239|ref|YP_001235366.1| gi|326404654|ref|YP_004284736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]