SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349163.Acry_2884 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349163.Acry_2884
Domain Number 1 Region: 4-21,58-202
Classification Level Classification E-value
Superfamily TerB-like 7.32e-17
Family COG3793-like 0.08
Further Details:      
 
Domain Number 2 Region: 190-252
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000000254
Family Chaperone J-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349163.Acry_2884
Sequence length 256
Comment (Acidiphilium cryptum JF-5)
Sequence
MSVWGKIIGGVAGFAVGGPFGAVAGAALGHAADTGDLGSLGARLGRALPLDSARFAALLG
RREQVFAIGATVLAAKLAKCDGPVVRAEIDAFKRQFRIEDAAIPTIGHLFDQAREDASGF
EPYARQLGESFADNRLALEQVLGALFAIARADGPVNAREADMLARIGALFGLGEAARARA
ANPSGGNLGEDPYQVLGIARTSSTEAIRAHWKALMRENHPDQLAARGVPAEFIARATERV
ARINAAWDAIKRERGA
Download sequence
Identical sequences A0A066PPK7 A5G2J2
gi|148261866|ref|YP_001235993.1| WP_012040385.1.19560 WP_012040385.1.67004 349163.Acry_2884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]