SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349307.Mthe_1311 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  349307.Mthe_1311
Domain Number - Region: 56-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0106
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349307.Mthe_1311
Sequence length 142
Comment (Methanosaeta thermophila PT)
Sequence
MNNSSSGEVPVMVGGPCEYEIYNGTATICSVTQTNESIGQAEVAGGPGYAGYEVRYEFTP
SEELPVWVSDYLNQSGNCSLLLQLCNSWYPGQAFLEKYNITEGAVFQARLSAIRSGTCTP
VVIELEDVDRCDYFESESSLTG
Download sequence
Identical sequences A0B8R5
gi|116754611|ref|YP_843729.1| 349307.Mthe_1311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]