SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349307.Mthe_1363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349307.Mthe_1363
Domain Number 1 Region: 51-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.25e-21
Family Cold shock DNA-binding domain-like 0.00089
Further Details:      
 
Domain Number 2 Region: 137-214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000968
Family ECR1 N-terminal domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349307.Mthe_1363
Sequence length 221
Comment (Methanosaeta thermophila PT)
Sequence
MDRKIVIPGDLLSEDTRRAGEGTYVRNGKVYSLLYGIASFRDRISVIPLAGKYIPAVGDN
VIGVVKDITFSNWILDINSPYDGLLHISEFPKKIDVEDMSKYLRIGSSVMARVKDVDPAM
KVELTLNDRRLGVIKTGRVVEISHTRVPRLIGKGGSMISMLKKELNCNIFVGQNGRIWVS
GNEEDMDLALKTILLIEREAHTNGLTDRIVEYIKDARRARG
Download sequence
Identical sequences A0B8W4
gi|116754660|ref|YP_843778.1| 349307.Mthe_1363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]