SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349519.LCK_00722 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349519.LCK_00722
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.87e-31
Family GHMP Kinase, N-terminal domain 0.00098
Further Details:      
 
Domain Number 2 Region: 153-268
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.64e-29
Family Homoserine kinase 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349519.LCK_00722
Sequence length 291
Comment (Leuconostoc citreum KM20)
Sequence
MIKIKVPATSANIGPGFDSLGLALDLFLTLEIHEATTTWQVIHEEPDLPHDITHFIVQAA
LTLTSNMQPHRLVVKSDIPLARGLGSSSAALLAGLTMANILADLNLSPKEILKQATMLEG
HPDNVAPALLGGAISAYYDGHQVYNSSFHIPENIIFTVFIPDYELKTAEARNALPDDFPF
KKSIAGSAISNTLIAALANDDWQTAKQLIEKDQFHEQQRHHLVPHLLEIRHIAHQHDVLG
TYLSGAGPTVITMAPENEAKILLPALTHLTTSGRTIQCHLNRSGLTITKEE
Download sequence
Identical sequences B1MYF2
gi|170017079|ref|YP_001727998.1| WP_004906992.1.20355 WP_004906992.1.26205 WP_004906992.1.75472 WP_004906992.1.79269 349519.LCK_00722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]