SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349521.HCH_02143 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349521.HCH_02143
Domain Number 1 Region: 3-121,189-302
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.49e-76
Family FabD-like 0.00000053
Further Details:      
 
Domain Number 2 Region: 129-196
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000000000379
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 349521.HCH_02143
Sequence length 305
Comment (Hahella chejuensis KCTC 2396)
Sequence
MNIAILFPGQGSQSIGMLSDLNQAYPLIAETFQEASDALGYDLWSLTQNGPEDQLNKTEI
TQPAILTASIALWRLYQQKVNPSVAFMAGHSLGEYSALVAAGVIGLQEAVKLVQLRGQLM
QKSVEGRATAMAAILGLGDQSVIDGCREAAAGECVEAVNFNCPGQVVIAGAESAVERAIV
ALKEKGAKRALKLAVSVPSHCALMKPAAEQLAEHIGSMAFDKPSTPVVQNVGARSVDDLA
ELKDNLIKQLFSPVLWTQSVQHISEKGVDSYVECGPGKVLAGLVKKIDRAASIQSLSDAE
VWNAL
Download sequence
Identical sequences Q2SK51
349521.HCH_02143 gi|83644963|ref|YP_433398.1| WP_011396043.1.94453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]