SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349741.Amuc_0382 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349741.Amuc_0382
Domain Number 1 Region: 296-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-44
Family Ribonuclease PH domain 1-like 0.0000121
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-42
Family Ribonuclease PH domain 1-like 0.0000396
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.33e-27
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 451-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.42e-21
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 561-646
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.84e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 626-708
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.17e-17
Family Cold shock DNA-binding domain-like 0.00067
Further Details:      
 
Domain Number 7 Region: 239-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000128
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349741.Amuc_0382
Sequence length 714
Comment (Akkermansia muciniphila ATCC BAA 835)
Sequence
MSIHSVECNVGTNPITIETGKMARLADGAVVVRSGDTVVLVTVVSATKVKEGQTFFPLSV
EYKEKAAAAGMFPGGYFKREGRPTEKEILTCRMTDRPLRPMFPKGYFYDTQVITLLLSAD
GENEPDILSINGASAACVVSDLPFAEPVGAVRVGRIDGQFVINPTNSQREHSQLDLVFAG
TKDQVIMIEGSANELPEEDFIAALRVAQENVKVICEKQEELRAVCGKEKRAYELCLAKPE
LLEIGYEIAGDRIEEAIYAPSKVERQKKVGALRDEVEAAIKERHPEATDFDVEQVFEYIQ
KKAFRISIMEKDKRADGRALKQLRPLTAEVNVLPPVVHGSAMFARGETMSLCLATLAPME
ERQYMDNYTGSVNEKRFILHYNFPPFSVGDTGRFGGQNRREIGHGALAERSIAPVVPGEQ
EFPYAIRVSSEIMESNGSTSMASVCAGTMSLLAAGVPLKRPVAGISVGLVTEQNDQHEIT
SYKTLLDIIGSEDFYGDMDFKLCGTSEGVTGYQLDLKLPGIPLSILEEAIHVAKAGRTDV
LKVMNEAIAAPAQMSPNAPRIETTKIPADRIGELIGPGGKNIKAIQAESGADINIEEDGT
VHIYAAKQEGLDRALELVTRMFKTIEIGELYTGKIVSTTTFGAFMEVLPGKDGLIHISEL
AEGRTAKTEDVVSVGDVVTAKCIGIDDKGRVKMSIRAALRDAKAAEAEAAGITE
Download sequence
Identical sequences A0A1Q6UPZ9 B2UNA9
349741.Amuc_0382 gi|187734890|ref|YP_001877002.1| WP_012419436.1.11081 WP_012419436.1.13503 WP_012419436.1.26090 WP_012419436.1.31314 WP_012419436.1.44559 WP_012419436.1.48500 WP_012419436.1.52179 WP_012419436.1.55880 WP_012419436.1.65144 WP_012419436.1.67314 WP_012419436.1.86927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]