SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350054.Mflv_2636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350054.Mflv_2636
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.4e-31
Family Ribosomal L27 protein 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 350054.Mflv_2636
Sequence length 88
Comment (Mycobacterium gilvum PYR-GCK)
Sequence
MAHKKGASSSRNGRDSNAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDDTLF
ATAPGAVEFGTKRGRKYVNIVRTVRSEA
Download sequence
Identical sequences A4T2J3 E6TDT4
gi|145223223|ref|YP_001133901.1| gi|315443681|ref|YP_004076560.1| WP_011893516.1.11461 WP_011893516.1.22401 350054.Mflv_2636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]