SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350054.Mflv_2706 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350054.Mflv_2706
Domain Number 1 Region: 120-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.76e-38
Family Extended AAA-ATPase domain 0.082
Further Details:      
 
Domain Number 2 Region: 17-79
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000456
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 350054.Mflv_2706
Sequence length 353
Comment (Mycobacterium gilvum PYR-GCK)
Sequence
MAPRENASSDASQSSARSSSRIDVPPGLIMGLLGSSDENLRALERLLTADIHVRGNAISL
SGEPDDVALAERAVSELVAVVASGQTLTPDAVRHTVAMLAGMQDGTVEESPAEVLTLDIL
SRRGKTIRPKTLNQKRYVDAIDTHTIVFGIGPAGTGKTYLAMAKAVSALQGKQVSRIILT
RPAVEAGERLGFLPGTLSEKIDPYLRPLYDALHDMMDPELIPKLMSAGVIEVAPLAYMRG
RSLNDAFIILDEAQNTTGEQMKMFLTRLGFGSKMVVTGDITQVDLPGGAPSGLNTAMRVL
GDVDDIHFAELTSADVVRHRLVSEIVDAYSKFEEPTLMNRAQRRASGPGRPRR
Download sequence
Identical sequences A4T2B9 E6TEL5
350054.Mflv_2706 gi|315443753|ref|YP_004076632.1| gi|145223293|ref|YP_001133971.1| WP_011893586.1.11461 WP_011893586.1.22401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]