SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_0058 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  350058.Mvan_0058
Domain Number - Region: 15-43
Classification Level Classification E-value
Superfamily R3H domain 0.0628
Family R3H domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_0058
Sequence length 70
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MSDNTTQAPRENAEKDTSQWVTGDEPMTGAQRSYLHTLAQEAGAGVPDDATKAQASDLID
ELQHLTGRGE
Download sequence
Identical sequences A1T159
WP_011777383.1.45031 350058.Mvan_0058 gi|120401086|ref|YP_950915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]