SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_1434 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_1434
Domain Number 1 Region: 22-137
Classification Level Classification E-value
Superfamily Translational machinery components 3.92e-50
Family Ribosomal protein L18 and S11 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_1434
Sequence length 137
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MAQAKKGGAPKKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGF
KGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAISD
VTPQPHNGCRPPKRRRV
Download sequence
Identical sequences A1T518
WP_011778694.1.45031 WP_011778694.1.58012 gi|120402445|ref|YP_952274.1| 350058.Mvan_1434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]