SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_2350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_2350
Domain Number 1 Region: 14-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-44
Family Ribonuclease PH domain 1-like 0.000000414
Further Details:      
 
Domain Number 2 Region: 328-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-43
Family Ribonuclease PH domain 1-like 0.0000017
Further Details:      
 
Domain Number 3 Region: 157-267
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.67e-28
Family Ribonuclease PH domain 2-like 0.00000944
Further Details:      
 
Domain Number 4 Region: 481-584
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.5e-22
Family Ribonuclease PH domain 2-like 0.0000187
Further Details:      
 
Domain Number 5 Region: 592-679
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.23e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 271-351
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.71e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00023
Further Details:      
 
Domain Number 7 Region: 660-729
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000229
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_2350
Sequence length 754
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MSVVEIEDGVFESTATIDNGSFGTRTIRFEAGRLAQQAAGAVVAYLDDETMLLSATTASK
SPKEHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDRPLRPSFVSGLR
NEIQVVVTVLSLDPKDLYDVLAINAASASTQISGLPFSGPVGGVRVALIDGQWVAFPTVE
QLERAVFDMVVAGRKVGDDHKDVAIMMVEAEATENVIELVAGGAGAPTETVVAEGLEAAK
PFIAVLCDAQAALAGAAGKETAEYPLFPDYGDDVYYSVASVATEALSEALTIAGKNERND
RTDEIKVEVLNRLAEQYAGREKEIGAAYRSLTKKLVRQRILTDHFRIDGRGVTDIRALSA
EVAVVPRAHGSALFERGETQIMGVTTLDMVKMAQQIDSLGPETSKRYMHHYNFPPYSTGE
TGRVGSPKRREIGHGALAERALVPVLPSVEEFPYAIRQVSEALGSNGSTSMGSVCASTLS
LLNAGVPLKAPVAGIAMGLVSDDIEIDGKTERRFVTLTDILGAEDAFGDMDFKCAGTKDF
VTALQLDTKLDGIPSQVLAGALAQAKDARITILEVMAEAIDTPDEMSPYAPRITTIKVPV
DKIGEVIGPKGKMINSITEETGASISIEDDGTVFVGASNGEAAQAAIDKINAIANPQLPK
VGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGRGKRINKVEDVAKVGDKLRVEIADI
DNRGKISLVLVAEESETAADAPADAPVDAATTSS
Download sequence
Identical sequences A1T7L4
gi|120403341|ref|YP_953170.1| WP_011779576.1.45031 WP_011779576.1.58012 350058.Mvan_2350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]