SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_3206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_3206
Domain Number 1 Region: 9-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.83e-49
Family Methylesterase CheB, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_3206
Sequence length 258
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MTVTSTDDPLRGVVAIGGSAAGVEALSRVAAGLPEDLPFAVLMALHLPEQGPSVLAQIID
RAGPLPAVAAENGATLEPGRIYVAVPGRHLLTRDHRIVLSNGPSESGHRPALNALFRSVA
VSFGPRAIGVLLSGVLDDGVLGLAAIRARGGTTLCQSPDDALFAAMPSNALRAGVVDRTA
VAADMGAVLMGLARRGSSGHAKSTDAYLELENHIAMTEPLAELDLQTLGPPSGFTCPDCN
GSLLTVADGYYRCHIGHA
Download sequence
Identical sequences A1TA07
350058.Mvan_3206 gi|120404184|ref|YP_954013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]