SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350688.Clos_1289 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  350688.Clos_1289
Domain Number - Region: 16-65
Classification Level Classification E-value
Superfamily TM1646-like 0.0301
Family TM1646-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 350688.Clos_1289
Sequence length 113
Comment (Alkaliphilus oremlandii OhILAs)
Sequence
MKAILKDKTIILINSYPYKDLIKEMQGRRWNEIDKIWTVPATMENIKMLKSVIKVDAEIE
KLYQEEFNLNRRLHKEKATKNVIPIAPMPIKANPFQHQIRAYNMALQAMGVIK
Download sequence
Identical sequences A8MGA6
350688.Clos_1289 WP_012159146.1.49300 gi|158320323|ref|YP_001512830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]