SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 350688.Clos_1534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350688.Clos_1534
Domain Number 1 Region: 5-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-48
Family Ribonuclease PH domain 1-like 0.0000183
Further Details:      
 
Domain Number 2 Region: 289-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-47
Family Ribonuclease PH domain 1-like 0.00000706
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-29
Family Ribonuclease PH domain 2-like 0.0022
Further Details:      
 
Domain Number 4 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.31e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.97e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 619-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.04e-22
Family Cold shock DNA-binding domain-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 350688.Clos_1534
Sequence length 706
Comment (Alkaliphilus oremlandii OhILAs)
Sequence
MFKVFKKEIAGRVLEVEVGKLAQLSNGSCLLKYGQTAVLVNACASKSPREGIDFFPLSVD
YEEKMYAAGKIPGGFIKREGRPSENAILTSRLIDRPIRPLFPDGYRNDVQIIATVLSVDI
DCTPDIVAMLGSSIALSISDIPFQGPTASVHVGLVDGKLLINPTSDEREHSSLDLVVSGT
KDAVMMIEAGANEVTEAQMLEAILFAHEEIKNIISFIEEIAAEVGKEKQEVVTLEINEDF
ETEVRAYAKTRISEAIRTVEKLERNAKIELANEETINYFYEKYQEELNLKQIHTILDSIL
KEETRNLILYDKKRPDDRQHDEIRPISCEVDLLPKTHGSGLFTRGQTQVLSIVTLGAIGD
VQILDGLGKEESKRYMHHYNFPPYSVGETKMLRSPGRREIGHGALAERALEPMIPSQDDF
PYAIRVVSEVLASNGSSSQASVCGSTLSLLDAGVPLKDMVAGIAMGLVKEGDAVAILSDI
QGMEDHLGDMDFKVAGTAKGITAIQMDIKIKGIDEPILKDALEQARVGRLYILDKMKEAI
SSPRPELSPYAPRMLKMKIHPDKIREVIGSGGKTINKIIEDTGVKIDIENDGTIFIAAQT
QEAGELALSIINNIVREPEIGDIFKGKVIKLMNFGAFVEILPGKEGLVHISNLAHERVNK
VEDVLAVGDEIDVKVIEIDQQGKVSLSRKALLPKDNDKKQDDPQKA
Download sequence
Identical sequences A8MFB4
350688.Clos_1534 gi|158320566|ref|YP_001513073.1| WP_012159389.1.49300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]