SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI10077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI10077
Domain Number 1 Region: 95-167
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.97e-23
Family Skp1 dimerisation domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 9-77
Classification Level Classification E-value
Superfamily POZ domain 3.66e-16
Family BTB/POZ domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI10077
Sequence length 176
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MDGDDAHGTVKLVSKEGDTFEVPIEVAKLSNLVVTTLGEEDDYDDDDDNMVEIPLPNVKS
SVLAKVIEYCTHYNQDPMTPITTPLKSNRIEEIVQEWYAHFVDVEQILLFELVTAANFMD
IKALLDLTCLAVSVLIKGKSAEEIRRIFNISNDFSPEEEAQVSKENQFTDGTSSSS
Download sequence
Identical sequences B8CD48
XP_002294049.1.2071 jgi|Thaps3|10077|fgenesh1_pg.C_chr_15000067 35128.JGI10077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]