SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI11484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI11484
Domain Number 1 Region: 9-91
Classification Level Classification E-value
Superfamily POZ domain 3.14e-17
Family Tetramerization domain of potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI11484
Sequence length 176
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MADKVTKPKPVVFNVGGKHFEVSRTVIDQHEDSMLARLVSETWIENPEQAAFIDRDGFIF
AQILNYHGSVSFPRTVWKSDFLRDIEYYAIVREGESVDNVPEEFVKGPPASRKSKKHYDI
GQCLLCSIFGDSRSSSPFDVSVYAPTQRERNALLVRRCGDQEYGASASPGCALSSA
Download sequence
Identical sequences B8CEN7
35128.JGI11484 jgi|Thaps3|11484|fgenesh1_pg.C_chr_20000080 XP_002294708.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]