SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI2190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  35128.JGI2190
Domain Number - Region: 39-117
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0971
Family Fibrinogen coiled-coil and central regions 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI2190
Sequence length 174
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MPPKKNTKKKAADKKKDDLDGMPMSPGDTIKYLESQKQALEVQLTDKSETTADAIAACES
MKEELATTTQKYQDEKQLTMDVTRTMTRQYKGMQEDLLNKINERERIIQSLKDELETQKV
FHSEEIASKNRVIEQKDADAAERREETDCMFKHFANLLVDARLQICKHTKDGGD
Download sequence
Identical sequences B8BTM8
35128.JGI2190 jgi|Thaps3|2190|fgenesh1_pg.C_chr_2000145 XP_002287679.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]