SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI24389 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI24389
Domain Number 1 Region: 53-106
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI24389
Sequence length 232
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MIGYDRGGGGGGFGGFPYRSTHQQGQDGRGGGGRGHGRGRGNRRRRQPPPKSNTTLSAEL
KIPVNLRGKLVGRGGSTVKWLRETADAKVFVPQQQLGRQQRNQLQQGGDGDHEQPTTTTT
TYPVRVNTTELASLLHCLYEISSLLSNGNAPISCLVKMKTFERPSNSQAAVQIDIHGELL
FPTLSDVGDGTSLDDNNVSIHLLFRGTIGSASQSINVPSTQQLVAYVLWKRY
Download sequence
Identical sequences B8LBI6
35128.JGI24389 XP_002296492.1.2071 jgi|Thaps3|24389|estExt_fgenesh1_pg.C_chr_11a0260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]