SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI24926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI24926
Domain Number 1 Region: 172-207
Classification Level Classification E-value
Superfamily SAP domain 0.00000961
Family SAP domain 0.005
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily POZ domain 0.0000196
Family BTB/POZ domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI24926
Sequence length 214
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MSAPTLAVLCEDADEETTIPIVGVRFEIFQCMLRYAYGDDIPDELWKPTNNRNNSNNNIL
SSSPAMELLDAANRFGVVGLKILAESKVQQHNISIETASDLILYADAKNCPLLKEKAMDY
FVLHAEEIRKSPSFERIEESTHIMVELMDALLSSRRSSTNTLRSFSLGEQDVDYGSMSVN
LLRRMLEERGLDVDGSREMLIGRLEGWNVGRNNM
Download sequence
Identical sequences B8CCT3
35128.JGI24926 jgi|Thaps3|24926|estExt_fgenesh1_pg.C_chr_140314 XP_002293822.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]